Sale!

weareproudtotreateverycustomerwhocomestoourstorelikefamilyfindingtheavidmediacomposer1yearsubscriptionlegacyrenewal99383088700avidforourcustomersisourpassion0.jpg

Avid Media Composer 1-Year Subscription (Legacy) Renewal 9938-30887-00 Avid

$ 79,60

SKU: mode_7936765395194 Category: Plugin Tags: Avid, New Gear, Plug-Ins, Softwares

Description
shopping

AVID Media Composer 1-Year Subscription (Legacy) Renewal

Media Composer is always getting better with new features and improvements. And with your active plan, you get them as soon as we release them.

See what’s new in Avid Media Composer

Media Composer now speaks the same language as Pro Tools. With the latest release, you can export a Pro Tools session directly from Media Composer along with your video sequence and edit points. You can also record, punch-in, and monitor multichannel audio using the new MBOX Studio—and more.

Media Composer is also now available in a new team plan, making it easy to manage, deploy, and add multiple licenses as needed.

Enjoy the latest episode of The Rough Cut

The Rough Cut Podcast features in-depth interviews with the top film, television and documentary post production professionals working in the industry today. Listen to editors talk about their craft, their latest projects and collaborating with their team. Hosted by @MattFeury of Avid Technology.

CREATE INSPIRED STORIES

VIDEO EDITING

From first cut to final finishing, get the tools every video editor needs to create compelling stories faster.

GET WORKFLOWS THAT WORK

PRODUCTION TEAMS

Experience the collaborative, efficient workflows top video professionals rely on.

Accelerate your edit

Boost your Media Composer capabilities with advanced tools for color and news workflows.

Remote collaboration made easy

Enable editors to work from anywhere without changing their workflow and extend collaboration to assistants, showrunners, producers, and other creative contributors. Plus, it’s included with Media Composer | Enterprise at no additional charge!

Access your edit suite anywhere

Expand your production team and ramp up new projects at a moment’s notice with a fully provisioned virtual editing suite in the cloud—complete with cloud-optimized Media Composer software and Avid NEXIS storage.

Prompt Delivery and Professional Packaging

Our long-standing partnership with UPS FedEx DHL and other global carriers lets us offer a range of shipping services. Our warehouse staff is extremely skilled and will package your items according to our precise and exact specifications. Your goods will undergo an extensive inspection and be safely packaged prior to being sent out. Each day, we ship to thousands of customers in many countries. The fact that we are committed to becoming the biggest online retailer in the World is clear. These warehouses are in Europe in the same way as they are in USA.

Note: Orders that include more than one item are assigned a processing period depending on the item.

Before shipping, we will inspect thoroughly the items you have ordered. Most orders are shipped within 48 hours. Expected delivery time is between 3-7 days.

Returns

Stock is dynamic. It's not entirely managed by us since we are involved with multiple entities, including the factory and the storage. The actual stock can change at any moment. It is possible that your order may be out of stock once the order has been placed.

Our policy lasts for 30 days. We cannot exchange or refund your order if it has been 30 days from the date of purchase.

For your item to be returned it must be in its original packaging, unopened and in the condition you received it. The item must be in its original packaging.